Vitamin K (cas 12001-79-5) Molecular Structure

CAS No. 12001-79-5 (Vitamin K )

Molecular Formula: C31H46O2Molecular Weight: 450.7032

Related Products Information

Confirm Cancel
Contact Supplier
  • Vitamin K 12001-79-5 Food Additives White Powder

    Updatetime:Nov 17 2017

    FOB Price:1 USD/Kilogram Purity:99%min Min. Order:1/Kilogram Supply Ability:1000 Month/Kilogram

    DetailDesc:Name: Vitamin K Synonyms: Kanavit CAS Registry number: 12001-79-5 EINECS:201-564-2 Molecular Formula: C31H46O2 Boiling Point: 546.4°Cat760mmHg Flash Point: 200.4°C Density: 0.963g/cm 3 Safety Statements: Moderately toxic by subcutaneous route. An experimental teratogen...

    Tel:86-188-74586545
    Address:East and West Lake District, Wuhan, China
    Hubei XinRunde Chemical Co., Ltd

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Vitamin K

    Updatetime:Nov 17 2017

    FOB Price:2 USD/Kilogram Purity:95%, 99% Min. Order:1/Kilogram Supply Ability:100 Year/Metric Ton

    DetailDesc:Name: Vitamin K Synonyms: Kanavit CAS Registry number: 12001-79-5 EINECS:201-564-2 Molecular Formula: C31H46O2 Boiling Point: 546.4°Cat760mmHg Flash Point: 200.4°C Density: 0.963g/cm 3 Safety Statements: Moderately toxic by subcutaneous route. An experimental teratogen...

    Tel:86-571-88938639
    Address:9/F Unit 2 ChangdiTorch Building, 259 #WenSan Road
    Hangzhou Dayangchem Co., Ltd.

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier MSNMSN SkypeSkype

  • Vitamin K

    Updatetime:Jul 28 2016

    Purity:99 Min. Order:1/Kilogram Supply Ability:100 Year/Metric Ton

    Tel:0086-531-58773055
    Address:No.59 Gongye South RD

    Introduction:HaohuaindustryisalargegroupcorporationwhichengagedintheR&Dandmanufactureofchemicals.Wehaveearnedourselvesagoodreputationathomeandabroadwithadvancedtechnology,standardizedmanagementandwellestablishedservicesysterm.WehavedevelopedtoaveryfamousgroupcorporationEnterpriseinchemica...

    Jinan Haohua Industry Co., Ltd.

    Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Vitamin K1

    Updatetime:Aug 05 2013

    Tel:+86-(28)-8618-1366
    Address:Floor Block A,Huaxi Building,5 LinYin Road, Chengdu 610041,

    Introduction:Profile:SichuanHuaFaMeiEnterpriseCo.,Ltd.apecializesinofferingactivepharmaceuticalingredient,intermediates,plantextracts,chemicalrawmaterialsanddrugproducts.OurAPIsincludeantibiotics,vitamins,antipyretics&antalgics,hormones&corticoids,aminoacidsandsulfonamides.Weofferfinechemicalssuchashypnone,benzaldehyde,benzoicacid,pyridine,benzophenone,thiopheneandtheirramifications&diisocyanateseriesforspecia...

    Sichuan Huafamei Enterprise Co., Ltd.

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier

  • Vitamin K

    Updatetime:Jun 06 2012

    Tel:+86-571-88233073
    Address:Rm. 3-502,Building 3 Tucuiyuan,Lakeside Garden,No.176 Wenyi West Road, HangZhou,China
    HangZhou Peak Chemical Co.,Ltd

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+1-(845)-517-0135
    Address:119 Rockland Center, 300, Nanuet, New York 10954,

    Introduction:AdvancedCompoundsInternational(ACI)isaU.S.basedSalesOrganizationforBulkChemicals&APIs(ActivePharmaceuticalIngredients)tothePharmaceutical,PersonalCare,NutritionalandVeterinaryindustries.WeatACIprideourselvesonprovidingglobalsolutionstoyourrawmaterialneeds.Workinginclosecooperationwithquality-consciousmanufacturersfromaroundtheworld,weconsistentlyofferawiderangeofproductsatcompetitiveprices.Working...

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-(532)-82972622, 82972626
    Address:0703-0705RM, Shandong International Trade Mansion, 51Taiping Road, Qingdao 266001,

    Introduction:Profile:QingdaoOrientalTongxiangTradingCo.,Ltd.dealsintheimport&exportoffeedadditives,foodingredients,functionalsugars,veterinaryproductsandvitamins.Wealsoproducemedicineandnutritionproducts.OurAPIproductlineincludesaspirin,azithromycin,benzocaine,calciumgluconate,diclofenacsodium,gliclazide,heparinsodium,inosineandnaproxen.Ourfunctionalsugarsproductsareerythritol,fructose,isomaltitol,mannitol,mal...

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+1-(626)-964 6910
    Address:17920 East Ajax Circle, City of Industry, California 91748,

    Introduction:Profile:AIDP,Inc.producesvitamins,aminoacids,minerals,sportsnutrients,specialtychemicalsandherbalextracts.WedevelopandsupplyDCgrades,beadlets,specialmeshes,coatingandlowodorcompositions.

    AIDP, Inc.

    Country/Region:United States

    Contact Supplier

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-(21)-50272981
    Address:11-502 Lane 299, Bisheng Rd, Zhangjiang, Shanghai 201204,

    Introduction:Profile:ShanghaiSeebioBiotech,Incproducesbiochemicalproducts,naturalextracts,pharmaceuticalintermediates,finechemicalsandplantsextracts.Ourproductlineincludespolypeptides,enzyme,amylose,biochemicalreagentandphytohormone.OurstrongproductisvitaminK2,MK7andMK4.

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+1-(603)-635-2255
    Address:100 Bridge Street, Pelham, New Hampshire 03076,

    Introduction:Profile:MedicalIsotopes,Inc.manufacturesstableisotopechemicalslabeledwithdeuterium,C15,N15,O18andmetalisotopes.Weofferdeuteratedvitaminsandoxygen-18water.Wealsodealwithcustomsynthesis.Wespecializeinmulti-stepcustomsynthesisforpharmaceuticalcompanies,government,researchfacilitiesandhospitals.

    Medical Isotopes, Inc.

    Country/Region:United States

    Business Type: Manufacturer

    Contact Supplier

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+1-(617)-9383084
    Address:No. 472, 321 Walnut Street, Newtonville, Massachusetts 02460-1927,

    Introduction:Profile:BosgenChemicalInc.offersbulkdrugs,commoditychemicals,activepharmaceuticalingredients,chemicalintermediatesandnutritionaladditives.Weoffer1,1-cyclopropanedimethanol,1,1-cyclopropanedimethanolcyclicsulfite,2,6-dimethoxybenzaldehyde,3-amino-1,2-propanediol,3-chloro-1,2-propanediol,3-methylamino-1,2-propanediol,1,1-cyclohexanediaceticacid,2,4-dichloroquinazolineand2-chloro-4-amino-6,7-dimethox...

    Bosgen Chemical Inc.

    Country/Region:United States

    Contact Supplier

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-(22)-89894411
    Address:Room 4-3-601, XinKaiDongLi, BenXi Road, HongQiao District, Tianjin,

    Introduction:Profile:ImamInternationalGroup(Pharmaceutical)Co.,Limitedspecializesinofferingorganicchemicalproductsandveterinarydrugs.Weoffervariouschemicalproductsincludingnaturaltaurine,taurine,chitosan,saccharomyces,proteinlysozyme,vitamin,calciumascorbateandinositol.calciumpantothenateisanorganicvitamin.Itisawhitepowder,odorlesswithbittertaste.Thesearesolubleinwater,glycerol,almostinsolubleinethanol,chlorof...

    Imam International Group (Pharmaceutical) Co., Limited

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-27-87711369
    Address:430071

    Introduction:WuhanPharmaChemicalCo.,Ltd.islocatedinWuhan,China.Wearespecializedinmineralchelates,pharmaceuticalrawmaterials,vitamins,aminoacidsandnutraceuticalingredients.Andwealsoprovidecustomsynthesistosomeofourclients.Webuiltourin-houselaboratorytoensurethequalityforeverybatchofwhatwedelivered,fromgramstokilograms,fromLCLtoFCL.WealsoinvestedacertainsumoffundsontheR&Dfornewitems,whichenablesustobeingoodposit...

    Wuhan Pharma Chemical Co., Ltd.

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-(25)-8471 2602
    Address:P.O.Box. 139 Gulou Post Office, Nanjing, Jiangsu 210008,

    Introduction:Profile:Be-LongInt‘lGroupismainlyengagedintradingcefquinomesulfate,ceftiofursodium,ceftiofurHcl,amproliumHcl,fosfomycinsodium,nicarbazin,butylamidinehydrochloride,amproliumHclpremix,amproliumHcl,ethopabatepremix,nicarbazin,ethopabatepremix,enduracidin,enradin,enramycinandcolistinsulfatepremix.Wesupplyvitamink3,menadioneandsulphurpowder.

    Be-Long Int'l Group

    Country/Region:China

    Contact Supplier

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-(532)-8601-8268
    Address:Suite 301B, No.6, South Fuzhou Road, Qingdao, Shandong 266071,

    Introduction:Profile:QingdaoRainbowBio-techCo.,Ltd.offersnaturalcolorants,foodadditivesandpharmaceuticalrawmaterials.Ourproductsaresodiumcopperchlorophyllinliqiud,chlorophyllpaste,naturalphytol,copperchlorophyll,angelicaandvitamink1.Oursodiumcopperchlorophyllinliqiudisusedintoothpastes.Ourvitamink1isusedtoproducemulti-vitaminfoodstuffsandanimalfodderadditives.

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-(25)-84873444
    Address:1108, BLDG B, New Century Plaza, No 1, South Taiping Rd., Nanjing, Jiangsu 210002,

    Introduction:NanjingSamwonInternationalLimiteddealswithFineChemicals,Pharmaceuticals,APIs,DyesandPigments.WehavegoodcooperationwithmanyfactoriesandlaboratoriesinChina.OurproductscopescoverfourmainareasRawandFineChemicalsLaboratoryChemicalsandEquipmentsPharmaceuticalIntermediatesandAPIsOurPharmaIntermediatesandAPIsareCholineGlycerophosphate,Amino-DioxaoctanoicAcid,Cholestyramine,Alvimopan,Resveratrol&ExenatideA...

    Nanjing Samwon International Limited

    Country/Region:China

    Business Type: Trading Company

    Contact Supplier SkypeSkype

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-(21)-6251-0663

    Introduction:Profile:NuchemSourceCo.,Ltd.isasupplierofrawmaterialsofnutritionalsupplements,foodadditives,botanicextracts,steroids,vitaminsandpharmaceuticalrawmaterials.Ouraminoacidsarearginine,arginineisoketocaporate,creatinemonohydrate,dicreatinemalate,dimethylglycinehydrochloride,DL-phenylalanine,D-phenylalanine,glycocyamine,L-isoleucine,L-leucine,L-valine,L-glutaminehydrate,guanidinebutyricacid,guanidotauri...

    Nuchem Source Co., Ltd.

    Country/Region:China

    Contact Supplier

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:+86-(532)-8362-3236

    Introduction:Profile:FrakenBiochemCo.,Ltd.specializesinprovidingD-ribose,D-alpha-tocopherylacetate,nicotinicacid,linoleicacid,D-glucosaminehydrochloride,methylsulfone,ursolicacid,piperineandursodeoxycholicacid.Wealsooffercalciumpantothenate,zeaxanthin,ferrousgluconate,curcuminandrutin.

    Fraken Biochem Co., Ltd.

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier

  • Vitamin K1

    Updatetime:Nov 13 2010

    Tel:86-571-56286531
    Address:Sandun, Xihu Industry Park, Hangzhou City, Zhejiang 310030,

    Introduction:Profile:ZhejiangEsunChemicalCo.,Ltd.specializesindevelopingandmarketingnew-typepharmaceuticalsandintermediates.Ourproductcatalogincludessorafenib,lapatinibditosylate,erlotinib,sunitinibmalate,bicalutamide,imatinib,palonosetron,nilotinib,lapatinib,darifenacin,gefitinib,pregabalin,anastrozole,rubitecam,montelukast,calcipotriol,calcipotriene,calcitriol,alfacalcidol,faropenem,flavopiridolandlenalidomi...

    Zhejiang Esun Chemical Co., Ltd.

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier

References of Vitamin K cas 12001-79-5

} Toxicity

1.    

scu-mus LD50:700 mg/kg

    ARZNAD    Arzneimittel-Forschung. Drug Research. 8 (1958),25.

Safety

Moderately toxic by subcutaneous route. An experimental teratogen. When heated to decomposition it emits acrid smoke and irritating fumes.
WGK Germany: 2
RTECS: QJ5800000
F:
F 1: Sensitive to air and humidity.
F 8: Photosensitive.
F 9:  Keep under nitrogen.
F 10:  Keep under argon.