Calcitonin salmon (cas 47931-85-1) Molecular Structure

CAS No. 47931-85-1 (Calcitonin salmon )

Molecular Formula: C145H240N44O48S2Molecular Weight: 3431.8531

Related Products Information

Page:1/6 < >
Contact Supplier
  • Factory Supply Calcitonin salmon 47931-85-1

    Updatetime:Apr 25 2018

    FOB Price:1 USD/Gram Purity:99% Min. Order:10/Gram Supply Ability:5 Month/Metric Ton

    DetailDesc: English name: Calcitonin salmon English Synonyms: CALCITONIN, SALMON; CALCITONIN (SALMON I); CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2; CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (DISULFIDE BRIDGE Molecular formula: C145H240N44O48S2 Molecular weight: 3431.85 EINECS number: 256-342-8 CAS: 4...

    Tel:86-1732-7098554
    Address:shuanglong road,jiangning, nanjing,jiangsu
    Nanjing Bangnuo Biotechnology Co., Ltd

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Hot Sale high quality Calcitonin salmon Cas 47931-85-1with specialized manufacturer

    Updatetime:Apr 25 2018

    FOB Price:135 USD/Kilogram Purity:98% Min. Order:1/Gram Supply Ability:200 Month/Kilogram

    DetailDesc: Hot Sale high quality Calcitonin salmon Cas 47931-85-1with specialized manufacturer Specifications: 47931-85-1 Calcitonin salmon High purity Fast deliver:Professional partner Product Name Calcitonin salmon Synonyms CALCITONIN, SALMON;CALCITONIN (SALMON I) CAS No. 47931-85-1 EINE...

    Tel:0086-27-59207850
    Address:A2705,Dong Yi Shi Qu,129# XinHua Road
    Wuhan Fortuna Chemical Co., Ltd.

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier MSNMSN SkypeSkype

  • Calcitonin salmon 47931-85-1

    Updatetime:Apr 25 2018

    FOB Price:1 USD/Gram Purity:99% Min. Order:1/Gram Supply Ability:100 Day/Kilogram

    DetailDesc:Name: Calcitonin salmon Synonyms: Calciben;Calcimar;Calsyn;Calsynar;Catonin;Karil;L-Prolinamide,L-cysteinyl-L-seryl-L-asparaginyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucylglycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-a-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucyl...

    Tel:86-27-83214668
    Address:East and West Lake District, Wuhan, China
    Hubei XinRunde Chemical Co., Ltd

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Thyrocalcitonin

    Updatetime:Apr 25 2018

    FOB Price:2 USD/Kilogram Purity:95%, 99% Min. Order:1/Kilogram Supply Ability:77 Year/Metric Ton

    DetailDesc: Name: Calcitonin salmon Synonyms: Calciben;Calcimar;Calsyn;Calsynar;Catonin;Karil;L-Prolinamide,L-cysteinyl-L-seryl-L-asparaginyl-L-leucyl-L-seryl-L-threonyl-L-cysteinyl-L-valyl-L-leucylglycyl-L-lysyl-L-leucyl-L-seryl-L-glutaminyl-L-a-glutamyl-L-leucyl-L-histidyl-L-lysyl-L-leucy...

    Tel:86-571-88938639
    Address:9/F Unit 2 ChangdiTorch Building, 259 #WenSan Road
    Hangzhou Dayangchem Co., Ltd.

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier MSNMSN SkypeSkype

  • Calcitonin salmon

    Updatetime:Apr 19 2018

    Purity:97%

    DetailDesc:organic latermediates

    Tel:86-312-18103315327
    Address:east huaxia road pudong shanghai china
    shijiazhuang guizheng trade co.,ltd

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Trading Company

    Contact Supplier

  • Calcitonin salmon

    Updatetime:Apr 10 2018

    Purity:97.00% Min. Order:1/Gram Supply Ability:10 Month/Kilogram

    DetailDesc:CAS No.:47931-85-1;Name:Calcitonin salmon;Characters: white or off White powder;Assay:07%.;Brief Introduction:intermediates, drug discovery.

    Tel:86-25-83697070
    Address:Rm.902 Longyin Plaza, No. 217 Zhongshan Rd.(N) Nanjing 210009,China
    Nanjing Chemlin Chemical Co., Ltd.

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier MSNMSN SkypeSkype

  • Calcitonin salmon

    Updatetime:Mar 13 2018

    FOB Price:100 USD/Kilogram Purity:99% Min. Order:1/Kilogram Supply Ability:100 Month/Kilogram

    DetailDesc:APIs Pharmaceutical Adjuvant Biochemicals & Biotech products

    Tel:86-571-85829152
    Address:Room 606, Fuyi Center, #298 Quanfuqiao Road, Jiang
    Jinlan Pharm-Drugs Technology Co., Limited

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Calcitonin salmon

    Updatetime:Feb 06 2018

    Purity:90% Min. Order:10/Kilogram Supply Ability:200 Year/Metric Ton

    DetailDesc: Calcitonin salmon (CAS: 47931-85-1 ) Molecular formula ingredients: salmon peptide synthesis material Pharmacokinetic The editor One hour after muscle and subcutaneous injection, maximum blood drug concentration, the half-life of 70-90 minutes, absolute bioavailability in about ...

    Tel:86-574-89212210
    Address:Guangbo Center Office 2002, YinXianDaDao 1357
    MOSINTER GROUP LIMITED

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Calcitonin salmon

    Updatetime:Dec 11 2017

    Purity:90%

    DetailDesc: 1.ProName:Calcitonin salmon 2.Molecular Formula:C145H240N44O48S2 3.Purity:99% 4.Appearance:powder We are specialized in Chemical raw materials and Pharmaceutical intermediates.With the first-class products and high-quality service to meet market's demands. We have stocks,so we can delivery quickly when recieve payment. If you are interes...

    Tel:86-27-85442017
    Address:Room 2109, Fu Xing Building, Xinhua Road, Jianghan District, Wuhan City, Hubei Province
    Hebei Shuangchi Biological Technology Co.,Ltd

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Calcitonin salmon

    Updatetime:Aug 04 2017

    Purity:99%

    DetailDesc:Calcitonin salmon

    Tel:86-311-66600578
    Address:C-2103 Wonder Business Square, 15 Yuhua West Rd.
    AOPHARM

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier MSNMSN SkypeSkype

  • Calcitonin salmon

    Updatetime:Nov 13 2015

    DetailDesc:High quality with nice price! J&H chemical provides you with the best chemical compounds you are looking for!

    Tel:86-571-87396430
    Address:No.200 Zhenhua Rd.Xihu Industrial Park, Hangzhou 310030, China
    Hangzhou J&H Chemical Co., Ltd

    Diamond member Diamond member Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier

  • Calcitonin salmon

    Updatetime:Apr 19 2018

    Purity:98%

    DetailDesc:Shanghai Credit Asia Chemical Co., Ltd. is specialized in trading and developing active pharmaceutical ingredients, intermediates, API, and custom synthesis according to client’s requirements.We will provide you with better service, better quality, better price.

    Tel:86-21-61124658
    Address:Nianjiabang Rd, Pudong, Shanghai
    Shanghai Forever Synthesis Co.,Ltd.

    Audited Supplier

    Country/Region:China

    Business Type: Distributor/Wholesaler

    Contact Supplier

  • Salcatonin

    Updatetime:Jun 28 2017

    FOB Price:1 USD/Gram Purity:98% Min. Order:1/Gram Supply Ability:1kg Month/Kilogram

    DetailDesc:We could receive custom synthesis according to your requirements from lab scale to commercial scale

    Tel:86-21-60542966
    Address:Lane 299 Bisheng Rd,Pudong District
    Hui Chem Company Limited

    Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Calcitonin salmon

    Updatetime:Jun 06 2017

    Purity:contact us for more details about Calcitonin salmon, CAS:47931-85-1

    DetailDesc:FINETECH INDUSTRY LIMITED is a LONDON based CRO company providing drug discovery & development services to worldwide clients. FINETECH INDUSTRY LIMITED supplies the Calcitonin salmon, CAS:47931-85-1 with the most competitive price and the best quality. We can offer efficient service and the best package.Welcome the enquiries & orders arou...

    Tel:86-27-87465837
    Address:chukang Road, Wuhan, Hubei 430073,
    Finetech Industry limited.

    Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier

  • Calcitonin (salmon)

    Updatetime:Sep 29 2016

    FOB Price:1 RMB/Kilogram Purity:99(%) Min. Order:1/Kilogram Supply Ability:300000 Month/Kilogram

    DetailDesc: Salmon calcitonin manufacturer TEL: 13277907446 QQ: 1482608374 Production of salmon calcitonin, salmon calcitonin API Manufacturers salmon calcitonin, salmon calcitonin price Product Name: Calcitonin (salmon) CAS: 47931-85-1 EINECS: 256-342-8 Molecular formula: C145H240N44O48S2 ...

    Tel:86-27-59212929
    Address:daijiashan 45,jiangan economic departmen zone,wuhan,hubei,China
    Wuhan Dahua Weiye Pharmaceutical Co.,Ltd

    Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Calcitonin (salmon)

    Updatetime:Jul 28 2016

    Purity:99 Min. Order:1/Kilogram Supply Ability:100 Year/Metric Ton

    DetailDesc:1,2-Dithia-5,8,11,14,17,20-hexaazacyclotricosane,cyclic peptide deriv.;Calciben;Calcimar;Calcitonin (salmon reduced) cyclic(1?;7)-disulfide;Calcitonin (salmonreduced), cyclic (1?;7)-disulfide;Calsyn;Calsynar;Catonin;Karil;L-Prolinamide,L-cysteinyl-L-seryl-L-asparaginyl-L-leucyl-L...

    Tel:0086-531-58773055
    Address:No.59 Gongye South RD
    Jinan Haohua Industry Co., Ltd.

    Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Salmon Calcitonin Acetate 47931-85-1

    Updatetime:Dec 10 2015

    Min. Order:1/Gram Supply Ability:10 Month/Metric Ton

    DetailDesc:Salmon Calcitonin Acetate 47931-85-1

    Tel:86-571-85232161
    Address:6th Floor, Block C, 7th Building, Xigang Xinjie, Xihu Industrial Park, Sandun Town, Hangzhou, China
    AFINE CHEMICALS LIMITED

    Audited Supplier

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier SkypeSkype

  • Calcitonin (salmon)

    Updatetime:Apr 09 2018

    Purity:98% Min. Order:1/Gram Supply Ability:10 Month/Kilogram

    DetailDesc: Application Calcitonin (salmon) stimulates the bone formation and inhibits the bone resorption in postmenopausal osteoporotic women. Description Calcitonin (salmon) is a 32-amino acid polypeptide hormone that is produced in humans primarily by the parafollicular cells (also know...

    Tel:1-631-6197922
    Address:45-16 Ramsey Road Shirley, NY 11967, USA
    Creative Peptides

    Country/Region:United States

    Business Type: Manufacturer

    Contact Supplier

  • Salcitonin Acetate

    Updatetime:Dec 14 2017

    FOB Price:170 USD/Gram Purity:98% Min. Order:1/Gram Supply Ability:5000 Month/Gram

    DetailDesc: Full name: Salcitonin Acetate Cas No.: 47931-85-1 Sequence: H-Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys -Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2.(Cys1- Cys7 Disulfide bond) Acetate Salt Purity: ≥98.0% Single Impurity:≤0.50%...

    Tel:86-571-56926323
    Address:18 Haishu Road, Yuhang District ,Hangzhou, Zhejiang 311121
    Hangzhou Peptide Biochem Co.,Ltd

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier

  • Salmon Calcitonin Acetate

    Updatetime:Apr 06 2017

    DetailDesc:We are the leading supplier of APIs,inhibitors, animo-acids,peptide, other pharmaceutical intermediates, and custom synthesis products.

    Tel:86-519-86202821
    Address:Qixing building, Mingxin road, Changzhou,Jiangsu,China
    Rosewell Industry Co., Ltd

    Country/Region:China

    Business Type: Manufacturer

    Contact Supplier MSNMSN SkypeSkype

<Pre12345..6Next > Go to page

References of Calcitonin salmon cas 47931-85-1

} Toxicity

Organism Test Type Route Reported Dose (Normalized Dose) Effect Source
dog LD50 intramuscular > 1600iu/kg (1600iu/kg) BEHAVIORAL: FOOD INTAKE (ANIMAL)

GASTROINTESTINAL: NAUSEA OR VOMITING
Oyo Yakuri. Pharmacometrics. Vol. 31, Pg. 1053, 1986.
monkey LD50 intravenous > 320iu/kg (320iu/kg) ? Oyo Yakuri. Pharmacometrics. Vol. 31, Pg. 1053, 1986.
mouse LD50 intramuscular > 72800ug/kg (72.8mg/kg) ? Drugs in Japan Vol. -, Pg. 273, 1990.
mouse LD50 intravenous > 72800ug/kg (72.8mg/kg) ? Drugs in Japan Vol. -, Pg. 273, 1990.
mouse LD50 oral > 72800ug/kg (72.8mg/kg) ? Drugs in Japan Vol. -, Pg. 273, 1990.
mouse LD50 subcutaneous > 72800ug/kg (72.8mg/kg) ? Drugs in Japan Vol. -, Pg. 273, 1990.
rabbit LD50 intramuscular > 500iu/kg (500iu/kg) ? Oyo Yakuri. Pharmacometrics. Vol. 31, Pg. 1053, 1986.
rat LD50 intramuscular > 72800ug/kg (72.8mg/kg) ? Drugs in Japan Vol. -, Pg. 273, 1990.
rat LD50 intravenous > 72800ug/kg (72.8mg/kg) ? Drugs in Japan Vol. -, Pg. 273, 1990.
rat LD50 oral > 72800ug/kg (72.8mg/kg) ? Drugs in Japan Vol. -, Pg. 273, 1990.
rat LD50 subcutaneous > 72800ug/kg (72.8mg/kg) ? Drugs in Japan Vol. -, Pg. 273, 1990.

Safety

Safety Statements: 22-24/25?
S22:Do not breathe dust.?
S24/25:Avoid contact with skin and eyes.
WGK Germany: 3
RTECS: EV8000000
F: 3-10