Products
  • Products
  • Buy offers
  • Encyclopedia
  • Msds lib
  • Synthesis
  • Reach Info
  • Suppliers
Home> Products > Pharmaceuticals and Biochemicals > Animal Pharmaceuticals > CAS DataBase Listed 1 > CAS 106612-94-6
106612-94-6 structure

106612-94-6

  • Molecular Weight: 493.40574
  • Formula: C7H6O2S
  • Name: 6H-Cyclopenta[b]thiophen-6-one,4,5-dihydro-5-hydroxy-, (5S)-
  • Synonyms: GLP-1; Glucagon like peptide 1 (7-37)
Properties Safety and Handling MSDS Computational chemical data
Identification of 106612-94-6 Safety Data
  • [Safety Statements]
Properties
There are 75 suppliers who can provide 6H-Cyclopenta[b]thiophen-6-one,4,5-dihydro-5-hydroxy-, (5S)- with CAS No. 106612-94-6
Polypeptide Hormones GLP-1 CAS 106612-94-6 Glucagon-Relatedp...
  • Cas No:106612-94-6 
  • Purity:98% 
  • Formula:C21H11N5O8S 
  • Appearance:White powder 
  • Description:Superiority polypeptide hormones glp-1 cas 106612-94-6 glucagon-relatedpeptide 1 for the treatment of type 2 diabetes mellitus Details Polypeptide Hormones GLP-1 CAS 106612-94-6 Glucagon-Relatedpeptide 1 For The Treatment of Type 2 Diabetes Mellitus Molecular ...
  • Updatetime:Feb 25 2019 
Hangzhou Lingrui Chemical Co.,Ltd.
  • Tel:86 571-88092529
  • Address:327-B 2# Building Qinglan science park, 321# JinPeng Str. Xihu District Hangzhou City, PR.CHINA
Contact Supplier
high quality Tesamorelin 106612-94-6 exporter
  • Cas No:106612-94-6 
  • Purity:98% 
  • Formula:C21H11N5O8S 
  • Appearance:white powder 
  • Description:Superiority high quality tesamorelin 106612-94-6 exporter Details high quality Tesamorelin 106612-94-6 exporter Transportation:EMS,DHL, UPS,FEDEX Storage:Store in a well-closed container Keywords:Tesamorelin 106612-94-6,high quality Tesamorelin,Tesamorelin exp...
  • Updatetime:Feb 25 2019 
Xunteng International Trading Co.,Limited
  • Tel:86-0794-5259813
  • Address:Industrial Park C District,Jinxi County, Fuzhou,Jiangxi Province,China
Contact Supplier
high quality Tesamorelin 106612-94-6 exporter
  • Cas No:106612-94-6 
  • Purity:98% 
  • Formula:C21H11N5O8S 
  • Appearance:white powder 
  • Description:Superiority high quality tesamorelin 106612-94-6 exporter Details high quality Tesamorelin 106612-94-6 exporter Transportation:EMS,DHL, UPS,FEDEX Storage:Store in a well-closed container Keywords:Tesamorelin 106612-94-6,high quality Tesamorelin,Tesamorelin exp...
  • Updatetime:Feb 25 2019 
CHINA HUASHENG INTERNATIONAL LIMITED
  • Tel:319-2296689
  • Address:QiaoXi Zone
Contact Supplier
high quality Tesamorelin 106612-94-6 exporter
  • Cas No:106612-94-6 
  • Purity:98% 
  • Formula:C21H11N5O8S 
  • Appearance:white powder 
  • Description:Superiority high quality tesamorelin 106612-94-6 exporter Details high quality Tesamorelin 106612-94-6 exporter Transportation:EMS,DHL, UPS,FEDEX Storage:Store in a well-closed container Keywords:Tesamorelin 106612-94-6,high quality Tesamorelin,Tesamorelin exp...
  • Updatetime:Feb 25 2019 
Hangzhou Yierdechem Co. Ltd
  • Tel:+86-571-86904883
  • Address:903,zhijiang Minglou, Xiasha EDA, Hangzhou City 310018,P.R.China
Contact Supplier
GLP-1 (7-37) Acetate
  • Cas No:106612-94-6 
  • Min.Order:0/Metric Ton 
  • Purity:99% 
  • Supply Ability:Metric Day/Ton 
  • Formula:C21H11N5O8S 
  • Description:Superiority enterprise standard Details Keywords:GLP-1 (7-37) Acetate
  • Updatetime:Feb 25 2019 
Hangzhou Haiqiang Chemical Co.,Ltd.
  • Tel:+86-571-86050390 87153572
  • Address:Add: 5/F, Around Town North Road,No. 10, Hangzhou, Zhejiang,China
Contact Supplier
GLP-1 (7-37) Acetate
  • Cas No:106612-94-6 
  • Purity:98% 
  • Formula:C21H11N5O8S 
  • Appearance:White powder or white crystalline soli... 
  • Description:Superiority peptide in stock Details Molecular Formula:C137H212N40O30 Keywords:His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-
  • Updatetime:Feb 25 2019 
Ningbo Distant Chemicals Co.,Ltd
  • Tel:86-574-27862490,27862438
  • Address:5F-3,#54 DaShaNi street,Ningbo,CHINA
Contact Supplier
Glp-1 (7-37) Acetate
  • Cas No:106612-94-6 
  • Purity:0.99 
  • Formula:C21H11N5O8S 
  • Appearance:White to off-white powder 
  • Description:Superiority glp-1 (7-37) acetate supplier Details Transportation:Sea/air/courier Storage:Keep away of light,cool place Keywords:106612-94-6 supplier,Glp-1 (7-37) Acetate supplier
  • Updatetime:Feb 25 2019 
ORCHID CHEMICAL SUPPLIES LTD
  • Tel:+86-571-85395792
  • Address:607, North Zhongshan Road, Hangzhou 310000 China
Contact Supplier
Human GLP-1 (7-37)
  • Cas No:106612-94-6 
  • Formula:C21H11N5O8S 
  • Description:Superiority Details Molecular Formula:C151H228N40O47
  • Updatetime:Feb 24 2019 
Wuxi Asiapeptide Co. Ltd.
  • Tel:86-510-83583050
  • Address:1699 HuiShan Road, Wuxi, Jiangsu Province, China
Contact Supplier
GLP-1
  • Cas No:106612-94-6 
  • Min.Order:0/Metric Ton 
  • Purity:98% 
  • Supply Ability:Metric Day/Ton 
  • Formula:C21H11N5O8S 
  • Appearance:white powder 
  • Updatetime:Feb 23 2019 
Shanghai HengXun Pharmaceutical Tech. Co., Ltd.
  • Tel:86-86-52730756
  • Address:Room 603, No. 240, Tianmuzhong Road, Zhabei, Shanghai, China
Contact Supplier
GLP-1,7-37
  • Cas No:106612-94-6 
  • Min.Order:0/Metric Ton 
  • Purity:98% 
  • Supply Ability:Metric Day/Ton 
  • Formula:C21H11N5O8S 
  • Description:Superiority popchem offers high qualified peptides at the most competitive prices in the industry within the fastest delivery and best service. service our peptide synthesis servi
  • Updatetime:Feb 23 2019 
Popchem Co., LTD
  • Tel:0551-67121910
  • Address:Luyang district,hefei city, China
Contact Supplier
GLP-1(7-37)
  • Cas No:106612-94-6 
  • Min.Order:100/Gram 
  • Purity:99% 
  • Supply Ability:500 Week/Kilogram 
  • Formula:C21H11N5O8S 
  • Description:Superiority we have most reliable quality, competitive prices and full documents for this apis 1. gmp workshop 2. dmf Details Senova means "Serve For Innovation", we are a professional company who's supplying APIs(mainly New Generics), Advanced Intermediates a...
  • Updatetime:Feb 23 2019 
Senova Technology Company Limited
  • Tel:+86-755-86703119
  • Address:309# in Building 3 of North Area, Dayuan Industry Park, Xili, Nanshan District of Shenzhen
Contact Supplier
GLP-1(7-37)Acetate
  • Cas No:106612-94-6 
  • Min.Order:1/Gram 
  • Purity:98% 
  • Formula:C21H11N5O8S 
  • Appearance:White or off-white lyophilized powder 
  • Description:Superiority watson international ltd' has a very strong r&d and technical capacity supported by fcad's platform. the subsidiaries under fcad group have accumulated much know-how of different fine chemical branches. for example, apnoke scientific ltd is the exp...
  • Updatetime:Feb 23 2019 
Watson International Ltd.
  • Tel:+86-(512)-55117610
  • Fax:+86-(512)-55117630
  • Address:Room 1209, Asia Pacific Plaza, Huaqiao International Business Park, Kunshan, Jiangsu 215332,
Contact Supplier
7-37-Glucagon-likepeptide I (human)
  • Cas No:106612-94-6 
  • Purity:98.0% 
  • Formula:C21H11N5O8S 
  • Appearance:White Solid 
  • Description:Superiority comply with cp,jp,ep,us grade Details Molecular Formula:C151H228N40O47 Transportation:Shipped as non- dangerous chemicals Storage:Stored under room temperature in cool ... Keywords:106612-94-6,7-37-Glucagon-likepeptide I (human)
  • Updatetime:Feb 23 2019 
Henan DaKen Chemical CO.,LTD.
  • Registered Time:0
  • Tel:+86-371-55541817
  • Address:No9,Inner Road,CBD,Zhengzhou ,China
Main Products
Daken chemica
Contact Supplier
7-37-Glucagon-likepeptide I (human)
  • Cas No:106612-94-6 
  • Purity:99.00 
  • Formula:C21H11N5O8S 
  • Appearance:detailed see specifications 
  • Description:Superiority joyinchem have been committed to chemical supply for several years and have built good cooperation records with multinational chemical corporations and importers from all over the world. our services include: -spot goods -contract manufacturing -cu...
  • Updatetime:Feb 22 2019 
Chungking Joyinchem Co., Ltd.
  • Tel:+86-23-77778019
  • Address:No. 55, Longhu Road, Xiangkou Town, Wulong District, Chungking City, 408500, P.R China
Contact Supplier
Human GLP-1 (7-37)
  • Cas No:106612-94-6 
  • Formula:C21H11N5O8S 
  • Description:Superiority Details Molecular Formula:C151H228N40O47
  • Updatetime:Feb 22 2019 
Wuxi Asia peptide biotechnology limited company
  • Tel:86-0510-83583053
  • Address:Wuxi Huishan District 1699 Avenue Huishan
Contact Supplier
GLP-1 (7-37) Acetate
  • Cas No:106612-94-6 
  • Formula:C21H11N5O8S 
  • Description:We are the leading supplier of APIs,inhibitors, animo-acids,peptide, other pharmaceutical intermediates, and custom synthesis products.
  • Updatetime:Apr 06 2017 
Rosewell Industry Co., Ltd
  • Category:Corporation/Limited Liability Company
  • Registered Time:2010
  • Registered Capital:Below US$100 Thousand
  • Employees:11 - 50 People
  • Tel:86-519-86202821
  • Fax:86-519-82059043
  • Address:Qixing building, Mingxin road, Changzhou,Jiangsu,China
Main Products
APIs, pharmaceutical intermediates, custom synthesis.
Contact Supplier
Glucagon-Like Peptide.(7-37);HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
  • Cas No:106612-94-6 
  • Purity:95%,98%,99% 
  • Formula:C21H11N5O8S 
  • Description:GL Biochem supplies high quality peptide reagents(Fmoc AA, Boc AA, coupling reagents, resins),peptides(custom peptides, catalogue peptides, pharmaceutical peptides, cosmetic peptides )and custom antibody service (monoclonal antibody, polyclonal antibody ).
  • Updatetime:Apr 14 2016 
GL Biochem(Shanghai) Ltd
  • Category:Corporation/Limited Liability Company
  • Registered Time:1998
  • Registered Capital:US$501 Thousand - US$1 Million
  • Legal Representative:Dr Hongyan Xu
  • Employees:Above 1000 People
  • Tel:86-21-61263452
  • Fax:86-21-61263399
  • Address:519 Ziyue Road 200241 China
Main Products
custom peptides, catalogue peptides, pharmaceutical peptides, cosmetic peptides,monoclonal antibody, polyclonal antibody,FMOC-ARG(PBF)-OH,FMOC-LYS(ME.BOC)-OH
Contact Supplier
Human GLP-1 (7-37)
  • FOB Price:Inquiry USD/Gram 
  • Cas No:106612-94-6 
  • Min.Order:1/Gram 
  • Purity:95% 
  • Supply Ability:100 Day/Gram 
  • Formula:C21H11N5O8S 
  • Updatetime:Mar 29 2016 
Boc Sciences
  • Registered Time:2005
  • Employees:101 - 500 People
  • Tel:1-631-5046093
  • Fax:1-631-6147828
  • Address:45-16 Ramsey Road, Shirley, NY 11967, USA
Main Products
building blocks, synthetic intermediates, custom synthesis
Contact Supplier
GLP-1 (7-37) Acetate
  • Cas No:106612-94-6 
  • Purity:98.0% 
  • Formula:C21H11N5O8S 
  • Appearance:White powder 
  • Description:Product Data Sheet Product Name GLP-1 (7-37) Acetate Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
  • Updatetime:May 15 2015 
Mimotopes Peptides company
  • Category:Corporation/Limited Liability Company
  • Registered Time:1988
  • Registered Capital:US$1 Million - US$2.5 Million
  • Legal Representative:Zhou Min
  • Employees:51 - 100 People
  • Tel:86-510-83583038
  • Fax:86-510-83583038
  • Address:Life Park #C50111, Huishan Economic Development District
Main Products
Fmoc-amino acid;Boc-amino acid;Other protective amino acid;Peptides;Custom peptides;Synphase Lantern
Contact Supplier
GLP-1;GLP-1 (7-37) Acetate;106612-94-6;Pharmaceutical peptid...
  • Cas No:106612-94-6 
  • Purity:98% 
  • Formula:C21H11N5O8S 
  • Appearance:White powder 
  • Description:Sequence:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH Molecular Formula:C151H228N40O47 Molecular Weight:3355.74 Store at:Cool dry place(-20oC, away from the light) Appearance:W...
  • Updatetime:Aug 07 2014 
GL biochem(shanghai) Ltd
  • Category:Individual (Sole proprietorship)
  • Registered Time:1998
  • Registered Capital:Above US$100 Million
  • Legal Representative:Hongyan Xu
  • Employees:Above 1000 People
  • Tel:86-21-61263384
  • Fax:86-21-61263399
  • Address:GL Biochem(Shanghai) Ltd. 519 Ziyue Road, Shanghai
Main Products
custom and catalogue peptides, amino acids and antibodies
Contact Supplier
< Pre 1234Next >
Related Categories