Products
  • Products
  • Buy offers
  • Encyclopedia
  • Msds lib
  • Synthesis
  • Reach Info
  • Suppliers
Home> Products > Pharmaceuticals and Biochemicals > Pharmaceutical > CAS DataBase Listed 1 > CAS 16941-32-5
16941-32-5 structure 3D

16941-32-5

  • Molecular Weight: 3482.7473
  • Formula: C29H44O4
  • Name: 5-Azuleneacetic acid,1,2,4,5,6,7,8,8a-octahydro-3,8-dimethyl-a-methylene-, (5S,8S,8aS)-
  • Synonyms: GLUCAGON 37; GLUCAGON 1-37; OXYNTOMODULIN; Glucagon (ox); Glucagon(pig); Human glucagon; Glucagon (dog); Bovine glucagon; GLUCAGON ACETATE; OXYNTOMODULIN (PORCINE); GLUCAGON (1-37) (PORCINE); Glucagon (Xenopus laevis); Glucagon(Mesocricetus auratus); HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA; 6: PN:JP2003161732 SEQID: 6 unclaimed sequence; 11: PN: WO2008041849 SEQID: 11 claimed protein; 10: PN: WO2008036970 FIGURE: 2 unclaimed seq...
Properties Safety and Handling MSDS Computational chemical data
Identification of 16941-32-5
  • Cas NO.:16941-32-5
  • Name:
  • 5-Azuleneacetic acid,1,2,4,5,6,7,8,8a-octahydro-3,8-dimethyl-a-methylene-, (5S,8S,8aS)- (Related Reference)
  • InChI:
  • InChI=1/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/m0/s1
  • This structure is also available as a 2d Mol file
Safety Data
Properties
  • Appearance:
  • powder
  • Molecular Weight:
  • 3482.7473
  • Density:
  • 1.47
  • Flash Point:
  • 422.7°C
  • Storage Temperature:
  • −20°C
  • Solubility:
  • SOL IN DIL ALKALI & ACID SOLN; INSOL IN MOST ORG SOLVENTS
    PRACTICALLY INSOL IN WATER
  • More Properties>>
There are 143 suppliers who can provide 5-Azuleneacetic acid,1,2,4,5,6,7,8,8a-octahydro-3,8-dimethyl-a-methylene-, (5S,8S,8aS)- with CAS No. 16941-32-5
Manufacture favorable price Glucagon Cas 16941-32-5 with goo...
  • FOB Price:135 USD/Kilogram 
  • Cas No:16941-32-5 
  • Min.Order:1/Kilogram 
  • Purity:99% 
  • Supply Ability:1000 Month/Kilogram 
  • Formula:C153H225N43O49S 
  • Payment:L/C,T/T,Western Union,MoneyGram, 
  • Updatetime:Jan 07 2020 
Wuhan Fortuna Chemical Co., Ltd.
  • Category:LLC (Ltd Liability Corp)
  • Registered Time:2006
  • Registered Capital:US$50 Million - US$100 Million
  • Employees:51 - 100 People
  • Tel:0086-27-59207850
  • Fax:0086-27-59524646
  • Address:A2705,Dong Yi Shi Qu,129# XinHua Road
-114YR Main Products
API
Contact Supplier
Glucagon
  • FOB Price:2 USD/Kilogram 
  • Cas No:16941-32-5 
  • Min.Order:1/Kilogram 
  • Purity:95%, 99% 
  • Supply Ability:10 Year/Metric Ton 
  • Formula:C153H225N43O49S 
  • Payment:T/T, L/C 
  • Updatetime:Dec 20 2019 
Hangzhou Dayangchem Co., Ltd.
  • Category:Corporation/Limited Liability Company
  • Registered Time:2000
  • Registered Capital:US$501 Thousand - US$1 Million
  • Legal Representative:Tang
  • Employees:51 - 100 People
  • Tel:86-571-88938639
  • Fax:86-571-88938652
  • Address:9/F Unit 2 ChangdiTorch Building, 259 #WenSan Road
8YRS Main Products
Chemical products
Contact Supplier
Glucagon?HCl
  • FOB Price:0 USD/Kilogram 
  • Cas No:16941-32-5 
  • Min.Order:1/Kilogram 
  • Purity:99% 
  • Supply Ability:200kgs Month/Kilogram 
  • Formula:C153H225N43O49S 
  • Payment:TT,LC,DA,DP 
  • Updatetime:Dec 18 2019 
Hangzhou Utanpharma biology co,.Ltd
  • Category:LLC (Ltd Liability Corp)
  • Registered Time:2009
  • Registered Capital:US$1 Million - US$2.5 Million
  • Employees:11 - 50 People
  • Tel:86-571-87758665
  • Fax:86-571-86821328
  • Address:Room 60M(604), Block A1-3, Hangzhou Zhejiang China
3YRS Main Products
Our company is an internationally oriented research based pharmaceutical company with headquarters located in Hangzhou,China.
Contact Supplier
Glucagon
  • FOB Price:100 USD/Kilogram 
  • Cas No:16941-32-5 
  • Min.Order:1/Kilogram 
  • Purity:99% 
  • Supply Ability:100 Month/Kilogram 
  • Formula:C153H225N43O49S 
  • Payment:T/T 
  • Updatetime:Dec 06 2019 
Jinlan Pharm-Drugs Technology Co., Limited
  • Category:Corporation/Limited Liability Company
  • Registered Time:2005
  • Registered Capital:US$50 Million - US$100 Million
  • Legal Representative:Shelly Cao
  • Employees:51 - 100 People
  • Tel:86-571-85829152
  • Fax:86-571-85829153
  • Address:Room 606, Fuyi Center, #298 Quanfuqiao Road, Jiang
7YRS Main Products
Veterinary products,Nutrition products,Agrochemicals,Active pharmaceutical Ingredients,Custom systhesis,Contract manufacturing
Contact Supplier
High quality Glucagon Acetate supplier in China
  • FOB Price:1 USD/Kilogram 
  • Cas No:16941-32-5 
  • Min.Order:1/Kilogram 
  • Purity:99%min 
  • Supply Ability:200 Year/Metric Ton 
  • Formula:C153H225N43O49S 
  • Payment:T/T, L/C 
  • Updatetime:Jun 26 2019 
Xiamen Zhongyuan Hongye Chemical Co., Ltd.
  • Registered Time:0
  • Employees:51 - 100 People
  • Tel:+86-0592-5567629
  • Fax:+86-0592-5567629
  • Address:No. 3 Tonglin Square, Changle Road, Xiamen, China (Fujian) Free Trade Pilot Area, B502
1YR Main Products
pharmaceutical intermediates, biochemistry and customized chemicals, special chemicals, organic and inorganic chemicals, medical devices, electronic chemicals and biological sciences
Contact Supplier
CAS 16941-32-5 Glucagon
  • FOB Price:1 USD/Gram 
  • Cas No:16941-32-5 
  • Min.Order:100/Gram 
  • Purity:99.9% 
  • Supply Ability:10000 Month/Kilogram 
  • Formula:C153H225N43O49S 
  • Payment:T/T,Western Union,MoneyGram, 
  • Updatetime:Mar 26 2019 
Hubei XinRunde Chemical Co., Ltd
  • Category:Individual (Sole proprietorship)
  • Registered Time:2011
  • Registered Capital:US$5 Million - US$10 Million
  • Legal Representative:Haixia Xiang
  • Employees:501 - 1000 People
  • Tel:86-188-74586545
  • Fax:86-27-83214668
  • Address:East and West Lake District, Wuhan, China
Main Products
Pharmaceutical Intermediate; Pharmaceutical Raw Materials; Raw Steroid Powders; Raw Hormone Powders; etc
Contact Supplier
Glucagon 16941-32-5 supplier
  • Cas No:16941-32-5 
  • Min.Order:1/Milligram 
  • Purity:97% 
  • Supply Ability:100 Year/Metric Ton 
  • Formula:C153H225N43O49S 
  • Appearance:powder 
  • Updatetime:Feb 25 2019 
Nanjing Sunsure Chemical Technology Co., Ltd
  • Tel:+86-025-58535435
  • Address:Southeast University Science Park(SEUSP) Gaoxin, Nanjing, Jiangsu 210032, China
Contact Supplier
Glucagon
  • Cas No:16941-32-5 
  • Purity:97% 
  • Formula:C153H225N43O49S 
  • Einecs:232-708-2 
  • Description:organic latermediates
  • Updatetime:Dec 13 2018 
shijiazhuang guizheng trade co.,ltd
  • Category:LLC (Ltd Liability Corp)
  • Registered Time:2012
  • Registered Capital:US$1 Million - US$2.5 Million
  • Legal Representative:Li Na
  • Employees:11 - 50 People
  • Tel:86-312-18103315327
  • Fax:86-312-18103315327
  • Address:east huaxia road pudong shanghai china
Main Products
Indole products,Amines products
Contact Supplier
Glucagon
  • Cas No:16941-32-5 
  • Purity:contact us for more details about Glucagon, CAS:16941-32-5 
  • Formula:C153H225N43O49S 
  • Appearance:contact us for more details about Glucagon, CAS:16941-32-5 
  • Einecs:232-708-2 
  • Description:FINETECH INDUSTRY LIMITED is a LONDON based CRO company providing drug discovery & development services to worldwide clients. FINETECH INDUSTRY LIMITED supplies the Glucagon, CAS:16941-32-5 with the most competitive price and the best quality. We can offer eff...
  • Updatetime:Nov 21 2018 
Finetech Industry limited.
  • Category:Corporation/Limited Liability Company
  • Registered Time:2007
  • Registered Capital:US$501 Thousand - US$1 Million
  • Employees:11 - 50 People
  • Tel:86-27-87465837
  • Fax:86-27-87772287
  • Address:chukang Road, Wuhan, Hubei 430073,
Main Products
custom synthesis,Lab reagent,CRO,CMO,R&D research chemicals.such as CAS:4651-67-6;CAS:99-16-1;CAS:145100-50-1
Contact Supplier
Glucagon (swine)
  • Cas No:16941-32-5 
  • Min.Order:1/Kilogram 
  • Purity:99 
  • Supply Ability:100 Year/Metric Ton 
  • Formula:C153H225N43O49S 
  • Payment:LC 
  • Updatetime:Nov 21 2018 
Jinan Haohua Industry Co., Ltd.
  • Category:Corporation/Limited Liability Company
  • Registered Time:2006
  • Registered Capital:US$1 Million - US$2.5 Million
  • Legal Representative:Jay Kong
  • Employees:501 - 1000 People
  • Tel:0086-531-58773055
  • Fax:0086-531-58773066
  • Address:No.59 Gongye South RD
Main Products
Chlorodimethylsilane;1,1,3,3-tetramethyldisiloxane
Contact Supplier
Glucagon
  • FOB Price:10 USD/Kilogram 
  • Cas No:16941-32-5 
  • Min.Order:10/Gram 
  • Purity:99% 
  • Supply Ability:20 Month/Metric Ton 
  • Formula:C153H225N43O49S 
  • Payment:T/T,L/C,Western union,Moneygram 
  • Updatetime:Sep 11 2018 
Wuhan Senwayer Century chemical Co.,Ltd
  • Category:Corporation/Limited Liability Company
  • Registered Time:2014
  • Registered Capital:US$101 Thousand - US$500 Thousand
  • Employees:11 - 50 People
  • Tel:86-27-59009407
  • Fax:86-27-59707018
  • Address:20#Xudong Street,Wuhan China
Main Products
API,intermediate, Agrochemical,Amino Acids
Contact Supplier
Glucagon
  • Cas No:16941-32-5 
  • Formula:C153H225N43O49S 
  • Einecs:232-708-2 
  • Description:Glucagon
  • Updatetime:Jun 07 2018 
AOPHARM
  • Category:Corporation/Limited Liability Company
  • Registered Time:2010
  • Registered Capital:US$101 Thousand - US$500 Thousand
  • Legal Representative:Xuan Liu
  • Employees:11 - 50 People
  • Tel:86-311-66600578
  • Fax:86-311-66600576
  • Address:C-2103 Wonder Business Square, 15 Yuhua West Rd.
Main Products
Pharmaceutical Intermediate, API, Botanical Extract
Contact Supplier
Glucagon Hydrochloride
  • FOB Price:1 USD/Gram 
  • Cas No:16941-32-5 
  • Min.Order:1/Gram 
  • Purity:98% 
  • Supply Ability:100 Month/Kilogram 
  • Formula:C153H225N43O49S 
  • Payment:TT,Western Union 
  • Updatetime:Jun 28 2017 
Hui Chem Company Limited
  • Category:Corporation/Limited Liability Company
  • Registered Time:2008
  • Registered Capital:US$1 Million - US$2.5 Million
  • Employees:51 - 100 People
  • Tel:86-21-60542966
  • Fax:86-21-61916468
  • Address:Lane 299 Bisheng Rd,Pudong District
Main Products
API, Pharmaceutical intermediates, photoelectronic Materials
Contact Supplier
Glucagon
  • FOB Price:1 USD/Kilogram 
  • Cas No:16941-32-5 
  • Min.Order:1/Kilogram 
  • Purity:99% 
  • Supply Ability:300000 Year/Kilogram 
  • Formula:C153H225N43O49S 
  • Payment:L/C,T/T,Western Union,MoneyGram, 
  • Updatetime:Sep 29 2016 
Wuhan Dahua Weiye Pharmaceutical Co.,Ltd
  • Category:Partnership
  • Registered Time:2005
  • Registered Capital:US$101 Thousand - US$500 Thousand
  • Legal Representative:xusasa
  • Employees:51 - 100 People
  • Tel:86-27-59887160
  • Fax:86-27-59420980
  • Address:daijiashan 45,jiangan economic departmen zone,wuhan,hubei,China
Main Products
Pharmaceutical, pharmaceutical intermediat,hormone powders
Contact Supplier
98% Injectable Polypeptide Hormones CAS 16941-32-5 Vapreotid...
  • FOB Price:1 USD/vail 
  • Cas No:16941-32-5 
  • Min.Order:10/vail 
  • Purity:> 98.0% 
  • Supply Ability:1000000 Month/vail 
  • Formula:C153H225N43O49S 
  • Payment:L/C,D/A,D/P,T/T,Western Union,MoneyGran, 
  • Updatetime:Sep 21 2016 
Hubei Yuancheng Saichuang Technology Co., Ltd
  • Category:Individual (Sole proprietorship)
  • Registered Time:2002
  • Registered Capital:US$5 Million - US$10 Million
  • Legal Representative:evelyn@chembj.com
  • Employees:501 - 1000 People
  • Tel:86-27-68886732
  • Fax:0086-027-88048077
  • Address:28# Golden Avenue, Golden Industrial Zone, Zhengdian Street, Jiangxia District, Wuhan City, Hubei, P. R. China
Main Products
Anabolic Steroid Hormone Powder, Muscle Building Steroids, Oral Anabolic Steroids, Injectable Anabolic Steroids, Pharmaceutical Raw Materials, Food Additives, Flavor&,Fragrance
Contact Supplier
Glucagon
  • Cas No:16941-32-5 
  • Min.Order:1/Gram 
  • Supply Ability:10 Month/Metric Ton 
  • Formula:C153H225N43O49S 
  • Payment:TT ,LC, Western Union 
  • Einecs:232-708-2 
  • Description:Glucagon
  • Updatetime:Dec 10 2015 
AFINE CHEMICALS LIMITED
  • Category:Corporation/Limited Liability Company
  • Registered Time:2005
  • Legal Representative:Mr. Wei Fei
  • Tel:86-571-85232161
  • Fax:86-571-85134895
  • Address:6th Floor, Block C, 7th Building, Xigang Xinjie, Xihu Industrial Park, Sandun Town, Hangzhou, China
Main Products
Pharmaceutical raw material(API), Pharmaceutical Intermediate, optical brightening Agent (Fluorescent Brightener), dyes, pigments
Contact Supplier
Glucagon
  • Cas No:16941-32-5 
  • Formula:C153H225N43O49S 
  • Einecs:232-708-2 
  • Updatetime:Nov 25 2019 
Sichuan Tongsheng Amino acids Co.,Ltd.
  • Category:Corporation/Limited Liability Company
  • Registered Time:2003
  • Employees:101 - 500 People
  • Fax:+86-838-2274207
  • Address:Room1-11,No.19 North Tianshan Road Deyang SiChuan China
Main Products
amino acid
Contact Supplier
Glucagon
  • Cas No:16941-32-5 
  • Formula:C153H225N43O49S 
  • Einecs:232-708-2 
  • Updatetime:Nov 25 2019 
PolyPeptide Laboratories GmbH
  • Tel:+49 5331 9561 0
  • Fax:+49 5331 9561 13
Contact Supplier
Glucagon
  • Cas No:16941-32-5 
  • Formula:C153H225N43O49S 
  • Einecs:232-708-2 
  • Updatetime:Nov 25 2019 
Hangzhou Bm Chemical Co., Ltd
  • Tel:86 0571-82864080 87330289
  • Fax:+86-571-85026069
Contact Supplier
Glucagon
  • Cas No:16941-32-5 
  • Formula:C153H225N43O49S 
  • Einecs:232-708-2 
  • Updatetime:Nov 25 2019 
Shanghai Biochemical Co., Ltd
  • Tel:+86-21-50921947
  • Address:Suite 13-402, Lane 1260 E. Huaxia Rd., Shanghai
Contact Supplier
<Pre12345..8Next >
Related Categories