Identification
- Cas NO.:16941-32-5
- CID:16132283
- Name:
- Glucagon (Related Reference)
- EINECS:
- 232-708-2
- InChI:
- InChI=1S/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/m0/s1
Safety Data
Properties
- Molecular Weight:
- 3482.7473
- Density:
- 1.53
- Storage Temperature:
- Keep in dark place,Sealed in dry,2-8°C
- Refractive index:
- 1.682
- Solubility:
- Practically insoluble in water and in most organic solvents. It is soluble in dilute mineral acids and in dilute solutions of alkali hydroxides.
- More Properties>>
There are 152 suppliers who can provide Glucagon with CAS No. 16941-32-5
-
Manufacture favorable price Glucagon Cas 16941-32-5 with goo...
- FOB Price:135 USD/kilogram
- Min.Order:1 Kilogram
- Supply Ability:1000 Kilogram/Month
- Appearance:Powder
- Purity:99%
- Packaging:1kg/foil bag, 25kg/drum or as you required
- Usage:API
- Brand:Fortunachem
- Description:Manufacture favorable price Glucagon Cas 16941-32-5 with good quality Specifications: 16941-32-5
- Updatetime:Jun 05 2023
-
Glucagon
- FOB Price:10 USD/kg
- Min.Order:1 KG
- Supply Ability:100 MT/Month
- Appearance:powder
- Purity:99.9%
- Packaging:1 kg/drum/bag,or according to your requirement
- Usage:medical intermediate
- Brand:HSD
- Updatetime:Jun 05 2023
-
Glucagon
- FOB Price: USD/kg
- Min.Order:0.1 KG
- Supply Ability:100000 KG/Month
- Appearance:powder
- Purity:99%
- Packaging:Aluminum foil bag/custom/bucket
- Usage:Activate phosphorylase in myocardium, promote glycogen decomposition and have a similar ef
- Brand:SY
- Description:Contact Us
- Updatetime:Jun 05 2023
-
China Supply Pharmaceutical intermediate Glucagon CAS 16941-...
- FOB Price:55 USD/kg
- Min.Order:1 KG
- Supply Ability:100000000 KG/Day
- Appearance:powder/crystal/liquid
- Purity:99%
- Packaging:bags /drum /aluminum foil or according to sclient requirement
- Usage:medical intermediate
- Brand:Bao Enluo
- Description:Density 1.5± 0.1g /cm3 Molecular formula C153H225N43O49S Molecular weight 3482.747 Accurate mass 3480.615723
- Updatetime:Jun 05 2023
-
100% customs clearance,Glucagon,CAS NO.:16941-32-5,Factory d...
- FOB Price:100 USD/kg
- Min.Order:1 G
- Supply Ability:100 G/Month
- Appearance:white powder
- Purity:99.5%
- Packaging:1KG/5KG/25KG
- Usage:Pharmaceutical intermediate
- Brand:PHE
- Description:Company Description Wuhan Pu He Technology Co. LTD is a company mainly engaged in high qualit
- Updatetime:Jun 05 2023
-
China Supplier Glucagon Cas 16941-32-5
- FOB Price:10 USD/kg
- Min.Order:10 G
- Supply Ability:2000 KG/Month
- Appearance:White Powder
- Purity:99%
- Packaging:1 kg/bag, or according to your requirement
- Usage:Pharmaceutical Intermediates
- Brand:shdhuisheng
- Description:-Product Description-
- Updatetime:May 25 2023
-
China Supply Pharmaceutical intermediate Glucagon CAS 16941-...
- FOB Price:30 USD/kilogram
- Min.Order:10 Gram
- Supply Ability:100 Metric Ton/Day
- Appearance:powder/crystal/liquid
- Purity:99%
- Packaging:1kg/bag,25kg drums and 200kg drums
- Usage:Medical
- Brand:Xinlijie
- Description:Density 1.5± 0.1g /cm3 Molecular formula C153H225N43O49S Molecular weight 3482.747 Accurate mass 3480.615723 PSA 1564.04000 LogP -6.01 Appearance character powder Refractive index 1.682 Deatail Description: Packaging Detail: 1kg/bag,25kg drums and 200kg drums ...
- Updatetime:May 09 2023
-
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
- FOB Price:10 USD/kg
- Min.Order:1 KG
- Supply Ability:10000 KG/Day
- Appearance:White powder
- Purity:99
- Packaging:25kg/Carton
- Usage:1kg/bag
- Brand:tingxuan
- Description:Name: Glucagon Synonyms: Glucaton; GLUCAGON 37; Glucagon 1-29; GLUCAGON 1-37; GLUCAGON ACETATE; Glucagon Hydrochloride; OXYNTOMODULIN (PORCINE); Glucagon(1-29) Human HCl; GLUCAGON (1-37) (PORCINE); HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA; His-Ser-Gln-Gly-Thr-Phe...
- Updatetime:Apr 23 2023
-
Factory Supply Glucagon Acetate
- FOB Price:0.1 USD/kilogram
- Min.Order:1 Kilogram
- Supply Ability:2000 Metric Ton/Year
- Appearance:solid or liquid ( refer to COA)
- Purity:99.90%
- Packaging:25kgs/fiber drum or 200kgs/drum
- Usage:upon client's application
- Brand:Amitychem
- Description:Amitychem Corporation manufacture and supply Glucagon Acetate with with high quality, low price and bulk supply. We have been focusing on the research and production of concrete chemicals for 14+ years. Our product quality has ISO, SGS, CQC,FAMI-QS, etc. Cetif...
- Updatetime:Mar 01 2023
-
Glucagon
- FOB Price:0 USD/kilogram
- Min.Order:1 Kilogram
- Supply Ability:200kgs Kilogram/Month
- Purity:99%
- Packaging:proper packing
- Usage:pharmaceutical
- Brand:no
- Description:Hangzhou Utanpharma Biology Co., Ltd. is a R&D and manufacturing based, market oriented enterprise,specialized in the R&D and marketing of active pharmaceutical ingredients and intermediates. Supported by our highly qualified professor and technicians team,inc...
- Updatetime:May 31 2023
-
Glucagon
- FOB Price:1 USD/kilogram
- Min.Order:1 Kilogram
- Supply Ability:100000000 Kilogram/Month
- Appearance:white powder
- Purity:99min
- Packaging:25kg/bag or barrel,or as you request
- Usage:Daily Chemicals
- Brand:Crovell
- Description:Hebei Crovell Biotech Company is a professional chemical material supplier, if you have any requirements, please contact me: Galy whatsapp: +86 19930509591 wickr:galyzhang Telegram:199 3050 9591
- Updatetime:Jun 05 2023
-
Glucagon
- FOB Price:100 USD/kilogram
- Min.Order:1 Kilogram
- Supply Ability:100 Kilogram/Month
- Appearance:WHITE
- Purity:99%
- Packaging:25KG/DRUM
- Usage:APIs Pharmaceutical Adjuvant Biochemicals & Biotech products
- Brand:ROYAL
- Description:APIs Pharmaceutical Adjuvant Biochemicals & Biotech products
- Updatetime:May 31 2023
-
Superb factory supplier GlucagonTFA CAS NO.16941-32-5
- FOB Price:8.5 USD/kg
- Min.Order:1 KG
- Supply Ability:100 MT/Month
- Appearance:As specs
- Purity:99%
- Packaging:customization
- Usage:Used as pharmaceutical intermediate
- Brand:YOUZE
- Description:Quick Details Common Name glucagonTFA CAS Number 16941-32-5 Molecular Weight 3482.747 Density 1.5±0.1 g/cm3 Boiling Point N/
- Updatetime:Nov 25 2022
-
Glucagon(1-29)
- FOB Price:1 USD/gram
- Min.Order:0.01 Gram
- Supply Ability:1 Gram/Day
- Appearance:White powder
- Purity:99%
- Packaging:2mg/vial or as per your requirements
- Usage:medicinal polypeptide
- Brand:skype:noul_5
- Description:Product Name:Glucagon(1-29)(Human) Sequence:H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr- Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln- Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH Cas No.:16941-32-5 Molecular Formula :C153H225N43O49S Molecular Weight:3482.82 Purity (HPLC):...
- Updatetime:Apr 25 2017
-
Glucagon
- FOB Price:1 USD/kilogram
- Min.Order:1 Kilogram
- Supply Ability:300000 Kilogram/Year
- Appearance:powder
- Purity:99%
- Packaging:fiber drum
- Usage:pharmaceutical intermediate
- Brand:Dahua
- Description:Name: Glucagon CAS No.: 16941-32-5 Synonyms: Glucagon Formula: C153H225N43O49S Molecular Weight: 3482.75 Density: 1.539 g/cm3 Application: pharmaceutical intermediate
- Updatetime:Sep 29 2016
-
Glucagon
- FOB Price:10 USD/kilogram
- Min.Order:10 Gram
- Supply Ability:20 Metric Ton/Month
- Appearance:White Powder
- Purity:99%
- Packaging:1kg/foli bag,25kg/drum
- Usage:API-Active Pharmaceutical Ingredients
- Brand:Senwayer
- Description:1.Full experience of large numbers containers loading in Chinese sea port. 2.Fast shipment by reputed shipping line. 3.Packing with pallet as buyer's special request. 4.Best service after shipment with e mail. 5.Cargoes together with container sales seervice a...
- Updatetime:Jun 28 2020
-
Glucagon Hydrochloride
- FOB Price:1 USD/gram
- Supply Ability: Kilogram/Day
- Appearance:White powder
- Purity:98%
- Packaging:Sterile plastic bottles or vials
- Usage:Research purposes only Not for human use
- Brand:Mimotopes
- Description:English name：Glucagon Hydrochloride CAS：16941-32-5 Molecular Formula：C153H225N43O49S Molecular weight：3482.75 Sequence：H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-OH Purity：98% App...
- Updatetime:Aug 01 2014
-
High quality Glucagon Acetate supplier in China
- FOB Price:1 USD/kilogram
- Min.Order:1 Kilogram
- Supply Ability:200 Metric Ton/Year
- Appearance:Colorless liquid
- Purity:99%min
- Packaging:125kg/drum
- Usage:Intermediate
- Brand:Chemzhongyuan
- Description:Name: Glucagon Synonyms: GLUCAGON 37; GLUCAGON 1-37; OXYNTOMODULIN; Glucagon(pig); Glucagon (ox); Glucagon (dog); Human glucagon; Bovine glucagon; GLUCAGON ACETATE; OXYNTOMODULIN (PORCINE); GLUCAGON (1-37) (PORCINE); Glucagon (Xenopus laevis); Glucagon(Mesocri...
- Updatetime:Jul 13 2021
-
Glucagon Hydrochloride
- FOB Price:1 USD/gram
- Min.Order:1 Gram
- Supply Ability:100 Kilogram/Month
- Appearance:White solid
- Purity:98%
- Packaging:Aluminum foil bag,or according to your requirements.
- Usage:Pharm intermediate
- Brand:HuiChem
- Description:We could receive custom synthesis according to your requirements from lab scale to commercial scale
- Updatetime:Jun 28 2017
-
Glucagon 16941-32-5 supplier
- Min.Order:1 Milligram
- Supply Ability:100 Metric Ton/Year
- Appearance:powder
- Purity:97%
- Packaging:as your required
- Description:Superiority nanjing sunsure chemical technology co., ltd., established in 2009, has expanded a compositive entity from initially only as a small manufacturer. the company dedicated to the development, production and marketing of chemicals. sunsure covers whole...
- Updatetime:Feb 25 2019
About Products and Service
Guidechem will help you find Glucagon 16941-32-5 suppliers from 6 different countries and regions around the world,152 products, both certified manufacturers and traders. You can choose and inquire according to your actual needs.
Guidechem provides you with information matching service. If you have not found the right supplier, release the purchase inquiry, the system will automatically match the corresponding supplier for you, for you to quote, to meet your needs for product quality and price.
Guidechem, with its platform of more than 100,000 suppliers, can meet all your needs for products. Please place your order now and start a happy purchasing experience.
Related Categories
Related Products
skype
-113YR 
Chat On Messeger
