Guidechem | China Chemical Manufacturers,suppliers,B2B Marketplace
Products
  • Products
  • Buy offers
  • Encyclopedia
  • Suppliers
Home> Products > Pharmaceuticals and Biochemicals > Pharmaceutical > CAS DataBase Listed 1 > CAS 16941-32-5
16941-32-5 structure 3D

16941-32-5

  • Molecular Weight: 3482.7473
  • Formula: C18H20N4O4S
  • Name: 1,2-Dinitro-3-(trifluoromethyl)benzene
  • Synonyms: GLUCAGON 37; GLUCAGON 1-37; OXYNTOMODULIN; Glucagon (ox); Glucagon(pig); Human glucagon; Glucagon (dog); Bovine glucagon; GLUCAGON ACETATE; OXYNTOMODULIN (PORCINE); GLUCAGON (1-37) (PORCINE); Glucagon (Xenopus laevis); Glucagon(Mesocricetus auratus); HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA; 6: PN:JP2003161732 SEQID: 6 unclaimed sequence; 11: PN: WO2008041849 SEQID: 11 claimed protein; 10: PN: WO2008036970 FIGURE: 2 unclaimed seq...
Properties Safety and Handling MSDS Computational chemical data
Identification
  • Cas NO.:16941-32-5
  • Name:
  • 1,2-Dinitro-3-(trifluoromethyl)benzene (Related Reference)
  • InChI:
  • InChI=1/C153H225N43O49S/c1-72(2)52-97(133(226)176-96(47-51-246-11)132(225)184-104(60-115(159)209)143(236)196-123(78(10)203)151(244)245)179-137(230)103(58-83-64-167-89-29-19-18-28-87(83)89)183-131(224)95(43-46-114(158)208)177-148(241)120(74(5)6)194-141(234)101(54-79-24-14-12-15-25-79)182-138(231)105(61-117(211)212)185-130(223)94(42-45-113(157)207)171-124(217)75(7)170-127(220)91(31-22-49-165-152(160)161)172-128(221)92(32-23-50-166-153(162)163)174-146(239)110(69-199)191-140(233)107(63-119(215)216)186-134(227)98(53-73(3)4)178-135(228)99(56-81-33-37-85(204)38-34-81)180-129(222)90(30-20-21-48-154)173-145(238)109(68-198)190-136(229)100(57-82-35-39-86(205)40-36-82)181-139(232)106(62-118(213)214)187-147(240)111(70-200)192-150(243)122(77(9)202)195-142(235)102(55-80-26-16-13-17-27-80)188-149(242)121(76(8)201)193-116(210)66-168-126(219)93(41-44-112(156)206)175-144(237)108(67-197)189-125(218)88(155)59-84-65-164-71-169-84/h12-19,24-29,33-40,64-65,71-78,88,90-111,120-123,167,197-205H,20-23,30-32,41-63,66-70,154-155H2,1-11H3,(H2,156,206)(H2,157,207)(H2,158,208)(H2,159,209)(H,164,169)(H,168,219)(H,170,220)(H,171,217)(H,172,221)(H,173,238)(H,174,239)(H,175,237)(H,176,226)(H,177,241)(H,178,228)(H,179,230)(H,180,222)(H,181,232)(H,182,231)(H,183,224)(H,184,225)(H,185,223)(H,186,227)(H,187,240)(H,188,242)(H,189,218)(H,190,229)(H,191,233)(H,192,243)(H,193,210)(H,194,234)(H,195,235)(H,196,236)(H,211,212)(H,213,214)(H,215,216)(H,244,245)(H4,160,161,165)(H4,162,163,166)/t75-,76+,77+,78+,88-,90-,91-,92-,93-,94-,95-,96-,97-,98-,99-,100-,101-,102-,103-,104-,105-,106-,107-,108-,109-,110-,111-,120-,121-,122-,123-/m0/s1
  • This structure is also available as a 2d Mol file
Safety Data
Properties
  • Appearance:
  • powder
  • Molecular Weight:
  • 3482.7473
  • Storage Temperature:
  • −20°C
  • Solubility:
  • SOL IN DIL ALKALI & ACID SOLN; INSOL IN MOST ORG SOLVENTS
    PRACTICALLY INSOL IN WATER
  • More Properties>>
There are 144 suppliers who can provide 1,2-Dinitro-3-(trifluoromethyl)benzene with CAS No. 16941-32-5
Glucagon?HCl
Glucagon?HCl
  • FOB Price:0 USD/Kilogram 
  • Min.Order:1 Kilogram 
  • Supply Ability:200kgs Month/Kilogram 
  • Purity:99% 
  • Packaging:proper packing 
  • Usage:pharmaceutical 
  • Brand:no 
  • Payment:TT,LC,DA,DP 
  • Updatetime:Dec 18 2019 
Hangzhou Utanpharma biology co,.Ltd
3YRS Main Products
Our company is an internationally oriented research based pharmaceutical company with headquarters located in Hangzhou,China.
Contact Supplier Chat With Supplier Chat On Skype
Manufacture favorable price Glucagon Cas 16941-32-5 with good quality
Manufacture favorable price Glucagon Cas 16941-32-5 with goo...
  • FOB Price:135 USD/Kilogram 
  • Min.Order:1 Kilogram 
  • Supply Ability:1000 Month/Kilogram 
  • Appearance:Powder 
  • Purity:99% 
  • Packaging:1kg/foil bag, 25kg/drum or as you required 
  • Usage:API 
  • Brand:Fortunachem 
  • Payment:L/C,T/T,Western Union,MoneyGram, 
  • Updatetime:Jan 07 2020 
Glucagon
Glucagon
  • FOB Price:2 USD/Kilogram 
  • Min.Order:1 Kilogram 
  • Supply Ability:10 Year/Metric Ton 
  • Appearance:liquid or solid 
  • Purity:95%, 99% 
  • Packaging:clients requirement 
  • Usage:raw material used in Synthesis 
  • Brand:Dayang 
  • Payment:T/T, L/C 
  • Updatetime:Dec 20 2019 
High quality Glucagon Acetate supplier in China
High quality Glucagon Acetate supplier in China
  • FOB Price:1 USD/Kilogram 
  • Min.Order:1 Kilogram 
  • Supply Ability:200 Year/Metric Ton 
  • Appearance:Colorless liquid 
  • Purity:99%min 
  • Packaging:125kg/drum 
  • Usage:Intermediate 
  • Brand:Chemzhongyuan 
  • Payment:T/T, L/C 
  • Updatetime:Aug 05 2020 
Xiamen Zhongyuan Hongye Chemical Co., Ltd.
2YRS Main Products
pharmaceutical intermediates, biochemistry and customized chemicals, special chemicals, organic and inorganic chemicals, medical devices, electronic chemicals and biological sciences
Contact Supplier Chat With Supplier Chat On Skype
Glucagon
Glucagon
  • FOB Price:100 USD/Kilogram 
  • Min.Order:1 Kilogram 
  • Supply Ability:100 Month/Kilogram 
  • Appearance:WHITE 
  • Purity:99% 
  • Packaging:25KG/DRUM 
  • Usage:APIs Pharmaceutical Adjuvant Biochemicals & Biotech products 
  • Brand:ROYAL 
  • Payment:T/T 
  • Updatetime:Dec 06 2019 
Jinlan Pharm-Drugs Technology Co., Limited
8YRS Main Products
Veterinary products,Nutrition products,Agrochemicals,Active pharmaceutical Ingredients,Custom systhesis,Contract manufacturing
Contact Supplier Chat With Supplier
Glucagon
Glucagon
  • FOB Price:1 USD/Kilogram 
  • Min.Order:1 Kilogram 
  • Supply Ability:300000 Year/Kilogram 
  • Appearance:powder 
  • Purity:99% 
  • Packaging:fiber drum 
  • Usage:pharmaceutical intermediate 
  • Brand:Dahua 
  • Payment:L/C,T/T,Western Union,MoneyGram, 
  • Updatetime:Sep 29 2016 
Polypeptide Glucagon (CAS:16941-32-5 )
Polypeptide Glucagon (CAS:16941-32-5 )
  • FOB Price:28 USD/vial 
  • Min.Order:10 vial 
  • Supply Ability:5 Month/Kilogram 
  • Appearance:White powder 
  • Purity:99% 
  • Packaging:2mg/vial or as your request 
  • Usage:For Promoting Insulin & Islet Somatostatin 
  • Brand:SUPPER STEROIDS 
  • Payment:T/T,Western Union,MoneyGran, 
  • Updatetime:Sep 21 2016 
Hubei Yuancheng Saichuang Technology Co., Ltd
Main Products
Anabolic Steroid Hormone Powder, Muscle Building Steroids, Oral Anabolic Steroids, Injectable Anabolic Steroids, Pharmaceutical Raw Materials, Food Additives, Flavor&,Fragrance
Contact Supplier Chat With Supplier Chat On Skype
Glucagon
Glucagon
  • FOB Price:10 USD/Kilogram 
  • Min.Order:10 Gram 
  • Supply Ability:20 Month/Metric Ton 
  • Appearance:White Powder 
  • Purity:99% 
  • Packaging:1kg/foli bag,25kg/drum 
  • Usage:API-Active Pharmaceutical Ingredients 
  • Brand:Senwayer 
  • Payment:T/T,L/C,Western union,Moneygram 
  • Updatetime:Sep 11 2018 
CAS 16941-32-5 Glucagon
CAS 16941-32-5 Glucagon
  • FOB Price:1 USD/Gram 
  • Min.Order:100 Gram 
  • Supply Ability:10000 Month/Kilogram 
  • Appearance:White crystal powder 
  • Purity:99.9% 
  • Packaging:100g/ bag, 2 kg/ bag, 25kg/ carton or as required 
  • Usage:Pharmaceutical intermediates ,Pharmaceutical raw materials 
  • Brand:Xunrunde 
  • Payment:T/T,Western Union,MoneyGram, 
  • Updatetime:Mar 26 2019 
Hubei XinRunde Chemical Co., Ltd
Main Products
Pharmaceutical Intermediate; Pharmaceutical Raw Materials; Raw Steroid Powders; Raw Hormone Powders; etc
Contact Supplier Chat With Supplier Chat On Skype
Glucagon Hydrochloride
Glucagon Hydrochloride
  • FOB Price:1 USD/Gram 
  • Min.Order:1 Gram 
  • Supply Ability:100 Month/Kilogram 
  • Appearance:White solid 
  • Purity:98% 
  • Packaging:Aluminum foil bag,or according to your requirements. 
  • Usage:Pharm intermediate 
  • Brand:HuiChem 
  • Payment:TT,Western Union 
  • Updatetime:Jun 28 2017 
Hui Chem Company Limited
Main Products
API, Pharmaceutical intermediates, photoelectronic Materials
Contact Supplier Chat With Supplier Chat On Skype
Glucagon 16941-32-5 supplier
Glucagon 16941-32-5 supplier
  • Min.Order:1 Milligram 
  • Supply Ability:100 Year/Metric Ton 
  • Appearance:powder 
  • Purity:97% 
  • Packaging:as your required 
  • Description:Superiority nanjing sunsure chemical technology co., ltd., established in 2009, has expanded a compositive entity from initially only as a small manufacturer. the company dedicated to the development, production and marketing of chemicals. sunsure covers whole...
  • Updatetime:Feb 25 2019 
Glucagon
Glucagon
  • Appearance:contact us for more details about Glucagon, CAS:16941-32-5 
  • Purity:contact us for more details about Glucagon, CAS:16941-32-5 
  • Packaging:Glass bottle in aluminum foil bag, from mg scale to kg scale 
  • Usage:Chemicals, pharmaceutical research, pharmaceutical intermediates, reagents 
  • Brand:FINETECH 
  • Description:FINETECH INDUSTRY LIMITED is a LONDON based CRO company providing drug discovery & development services to worldwide clients. FINETECH INDUSTRY LIMITED supplies the Glucagon, CAS:16941-32-5 with the most competitive price and the best quality. We can offer eff...
  • Updatetime:Nov 21 2018 
Finetech Industry limited.
Main Products
custom synthesis,Lab reagent,CRO,CMO,R&D research chemicals.such as CAS:4651-67-6;CAS:99-16-1;CAS:145100-50-1
Contact Supplier Chat With Supplier
Glucagon (swine)
Glucagon (swine)
  • Min.Order:1 Kilogram 
  • Supply Ability:100 Year/Metric Ton 
  • Purity:99 
  • Packaging:According to your demand 
  • Payment:LC 
  • Description:Glucagon(pig);35: PN: WO2006017688 SEQID: 35 unclaimed sequence;393:PN: WO2007146038 SEQID: 393 unclaimed protein;3: PN: WO2006064378 SEQID: 3unclaimed sequence;474: PN: US20080312157 SEQID: 528 unclaimed sequence;6: PN:JP2003161732 SEQID: 6 unclaimed sequence...
  • Updatetime:Nov 21 2018 
Glucagon
Glucagon
  • Min.Order:1 Gram 
  • Supply Ability:10 Month/Metric Ton 
  • Payment:TT ,LC, Western Union 
  • Description:Glucagon
  • Updatetime:Dec 10 2015 
AFINE CHEMICALS LIMITED
Main Products
Pharmaceutical raw material(API), Pharmaceutical Intermediate, optical brightening Agent (Fluorescent Brightener), dyes, pigments
Contact Supplier Chat With Supplier Chat On Skype
Glucagon
Glucagon
  • Purity:97% 
  • Description:organic latermediates
  • Updatetime:Dec 13 2018 
Glucagon
Glucagon
  • Description:Glucagon
  • Updatetime:Jun 07 2018 
AOPHARM
Main Products
Pharmaceutical Intermediate, API, Botanical Extract
Contact Supplier Chat With Supplier Chat On Skype
Glucagon(1-29) Human Hydrochloride cas no 16941-32-5 EP/USP
Glucagon(1-29) Human Hydrochloride cas no 16941-32-5 EP/USP
  • FOB Price:1 USD/Gram 
  • Min.Order:1 Gram 
  • Supply Ability:200 Month/Kilogram 
  • Appearance:white powder 
  • Purity:99% 
  • Packaging:10g,100g,1kg 
  • Usage:APIs peptides 
  • Brand:Hangzhou Peptide Biochem 
  • Payment:L/C,T/T, 
  • Updatetime:Jun 17 2016 
Hangzhou Peptide Biochem Co., Ltd
Main Products
peptides,GMP peptide ,Cosmetic peptide,Custom peptide,Oxytocin,Leuprorelin,Glatiramer,Bivalirudin,Triptorelin,Terlipressin
Contact Supplier Chat With Supplier Chat On Skype
Glucagon Hydrochloride
Glucagon Hydrochloride
  • FOB Price:1 USD/Gram 
  • Supply Ability: Day/Kilogram 
  • Appearance:White powder 
  • Purity:98% 
  • Packaging:Sterile plastic bottles or vials 
  • Usage:Research purposes only Not for human use 
  • Brand:Mimotopes 
  • Payment:Western Union, 
  • Updatetime:Aug 01 2014 
Mimotopes Proprietary Limited, China
Main Products
Peptide(Custom peptide;Directory peptide;Pharmaceutical peptide;Cosmetics peptide;);Peptide Libraries;Synphase Lantern;Antibody;Resin;Amino acids
Contact Supplier Chat With Supplier
High purity Glucagon 16941-32-5 in stock immediately delivery good supplier
High purity Glucagon 16941-32-5 in stock immediately deliver...
  • FOB Price:1 USD/Kilogram 
  • Min.Order:1 Kilogram 
  • Supply Ability:10000 Day/Kilogram 
  • Appearance:Powder 
  • Purity:99% 
  • Packaging:25kg/drum 
  • Payment:L/C,D/A,D/P,T/T,Western Union,MoneyGram 
  • Updatetime:Feb 26 2019 
GLucagon
GLucagon
  • FOB Price:2 USD/Metric Ton 
  • Min.Order:1 Gram 
  • Supply Ability:100 Day/Gram 
  • Appearance:white powder 
  • Purity:98% 
  • Packaging:A variety of packing way 
  • Payment:T/T 
  • Updatetime:Feb 25 2019 
<Pre12345..8Next >
Related Categories